PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_09193-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 194aa    MW: 21252.9 Da    PI: 10.2444
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_09193-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.76.1e-1489141355
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      + +r rr+ +NRe+ArrsR+RK a++  Le  v++L++e  +L k+l e +++
  TRIUR3_09193-P1  89 DTRRIRRMVSNRESARRSRRRKHAQLTDLELQVEQLKSESATLFKQLTEANQQ 141
                      56899***************************************777776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-1387151IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.74989141IPR004827Basic-leucine zipper domain
PfamPF001702.4E-1190141IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-1191143No hitNo description
Gene3DG3DSA:1.20.5.1701.4E-1191142No hitNo description
PROSITE patternPS00036094109IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MMGGTAAVTQ NALELEGSNP GHLWWSEGLR APPHHAAPAP TQSQTPAVSA SPRETISGNQ  60
ALETESDSDS ESLVEIQGGR CKRSGKSSDT RRIRRMVSNR ESARRSRRRK HAQLTDLELQ  120
VEQLKSESAT LFKQLTEANQ QFTTAVTDNR ILKSDVETLR IKVKMAEDMV ARGAVSCGLG  180
QQLGLAPFLN SRKM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3613380.0AK361338.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1138D02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240308.18e-78PREDICTED: basic leucine zipper 9 isoform X1
SwissprotQ9FUD38e-42BZIP9_ARATH; Basic leucine zipper 9
TrEMBLM7ZTE21e-141M7ZTE2_TRIUA; Regulatory protein opaque-2
STRINGMLOC_58027.41e-113(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20953796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.14e-29basic leucine zipper 9